PDB entry 1uri

View 1uri on RCSB PDB site
Description: azurin mutant with met 121 replaced by gln
Deposited on 1996-11-14, released 1997-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1uria_
  • Chain 'B':
    Domains in SCOP 1.55: d1urib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uriA (A:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    qkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uriB (B:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    qkgtlklsn