PDB entry 1uri

View 1uri on RCSB PDB site
Description: azurin mutant with met 121 replaced by gln
Class: electron transport
Keywords: electron transport, copper, periplasmic
Deposited on 1996-11-14, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (120)
    Domains in SCOPe 2.08: d1uria_
  • Chain 'B':
    Compound: Azurin
    Species: Achromobacter denitrificans [TaxId:32002]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00280 (0-128)
      • conflict (120)
    Domains in SCOPe 2.08: d1urib_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uriA (A:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    qkgtlklsn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uriB (B:)
    aqceatiesndamqynlkemvvdksckqftvhlkhvgkmakvamghnwvltkeadkqgva
    tdgmnaglaqdyvkagdtrviahtkvigggesdsvtfdvskltpgeayayfcsfpghwam
    qkgtlklsn