PDB entry 1urh

View 1urh on RCSB PDB site
Description: the "rhodanese" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli
Deposited on 2003-10-30, released 2003-12-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-18, with a file datestamp of 2003-12-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urhA (A:)
    sttwfvgadwlaehiddpeiqiidarmaspgqedrnvaqeylnghipgavffdiealsdh
    tsplphmlprpetfavamrelgvnqdkhlivydegnlfsaprawwmlrtfgvekvsilgg
    glagwqrddllleegavelpegefnaafnpeavvkvtdvllashentaqiidarpaarfn
    aevdeprpglrrghipgalnvpwtelvregelkttdeldaiffgrgvsydkpiivscgsg
    vtaavvllalatldvpnvklydgawsewgaradlpvepvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urhA (A:)
    ttwfvgadwlaehiddpeiqiidarmaspgqedrnvaqeylnghipgavffdiealsdht
    splphmlprpetfavamrelgvnqdkhlivydegnlfsaprawwmlrtfgvekvsilggg
    lagwqrddllleegavelpegefnaafnpeavvkvtdvllashentaqiidarpaarfna
    evdelrrghipgalnvpwtelvregelkttdeldaiffgrgvsydkpiivscgsgvtaav
    vllalatldvpnvklydgawsew
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1urhB (B:)
    sttwfvgadwlaehiddpeiqiidarmaspgqedrnvaqeylnghipgavffdiealsdh
    tsplphmlprpetfavamrelgvnqdkhlivydegnlfsaprawwmlrtfgvekvsilgg
    glagwqrddllleegavelpegefnaafnpeavvkvtdvllashentaqiidarpaarfn
    aevdeprpglrrghipgalnvpwtelvregelkttdeldaiffgrgvsydkpiivscgsg
    vtaavvllalatldvpnvklydgawsewgaradlpvepvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urhB (B:)
    ttwfvgadwlaehiddpeiqiidarmaspgqedrnvaqeylnghipgavffdiealsdht
    splphmlprpetfavamrelgvnqdkhlivydegnlfsaprawwmlrtfgvekvsilggg
    lagwqrddllleegavelpegefnaafnpeavvkvtdvllashentaqiidarpaarfna
    rghipgalnvpwtelvregelkttdeldaiffgrgvsydkpiivscgsgvtaavvllala
    tldvpnvklydgawsew