PDB entry 1urg

View 1urg on RCSB PDB site
Description: x-ray structures from the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius
Class: maltose-binding protein
Keywords: maltose-binding protein, maltodextrin-binding protein, acidophile, thermoacidophile, hyperthermophile, thermophile
Deposited on 2003-10-29, released 2003-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urga_
  • Heterogens: MAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urgA (A:)
    cgtsnggqntspstssssakgeasalpkgqtitvwswqtgpelqdvkqiaaqwakahgdk
    vivvdqssnpkgfqfyataartgkgpdvvfgmphdnngvfaeeglmapvpsgvlntglya
    pntidaikvngtmysvpvsvqvaaiyynkklvpqppqtwaefvkdanahgfmydqanlyf
    dyaiiggyggyvfkdnngtldpnnigldtpgavqaytlmrdmvskyhwmtpstngsiaka
    eflagkigmyvsgpwdtadiekakidfgvtpwptlpngkhatpflgvitafvnkesktqa
    adwslvqaltsaqaqqmyfrdsqqipallsvqrssavqssptfkafveqlryavpmpnip
    qmqavwqamsilqniiagkvspeqgakdfvqniqkgimaqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urgA (A:)
    qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
    fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
    klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
    pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
    tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
    svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
    vqniqkgimaqgs