PDB entry 1urf

View 1urf on RCSB PDB site
Description: hr1b domain from prk1
Class: transferase
Keywords: transferase, g-protein, hr1 domain, kinase, helical, coiled coil, ATP-binding, serine/threonine-protein kinase, phosphorylation
Deposited on 2003-10-29, released 2003-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c-like 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1URF (0-2)
    • Uniprot Q16512 (3-80)
    Domains in SCOPe 2.08: d1urfa1, d1urfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urfA (A:)
    gipatnlsrvaglekqlaielkvkqgaenmiqtysngstkdrkllltaqqmlqdsktkid
    iirmqlrralqadqlenqaap