PDB entry 1ure

View 1ure on RCSB PDB site
Description: nmr structure of intestinal fatty acid-binding protein complexed with palmitate, 20 structures
Class: lipid binding protein
Keywords: lipid-binding, lipid transport, lipid binding protein
Deposited on 1996-06-17, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: intestinal fatty acid-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Gene: POTENTIAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urea_
  • Heterogens: PLM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ureA (A:)
    afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
    vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
    gveakrifkke