PDB entry 1urd

View 1urd on RCSB PDB site
Description: X-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium Alicyclobacillus acidocaldarius provide insight into acid stability of proteins
Class: maltose-binding protein
Keywords: maltose-binding protein, maltodextrin-binding protein, acidophile, thermoacidophile, hyperthermophile, thermophile
Deposited on 2003-10-29, released 2003-12-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose-binding protein
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1urda_
  • Chain 'B':
    Compound: maltose-binding protein
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1urdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urdA (A:)
    qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
    fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
    klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
    pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
    tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
    svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
    vqniqkgima
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1urdB (B:)
    qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
    fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
    klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
    pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
    tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
    svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
    vqniqkgima
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urdB (B:)
    titvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvvf
    gmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynkk
    lvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldtp
    gavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgvt
    pwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipalls
    vqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdfv
    qniqkgima