PDB entry 1urb

View 1urb on RCSB PDB site
Description: alkaline phosphatase (n51mg)
Class: alkaline phosphatase
Keywords: hydrolase, phosphoric monoester, phospho transferase, alcohol acceptor, alkaline phosphatase
Deposited on 1996-02-03, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.193
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-445)
      • engineered (47)
    Domains in SCOPe 2.07: d1urba_
  • Chain 'B':
    Compound: alkaline phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: PHOA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00634 (0-445)
      • engineered (47)
    Domains in SCOPe 2.07: d1urbb_
  • Heterogens: ZN, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urbA (A:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligngmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1urbB (B:)
    mpvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligngmgdseitaarn
    yaegaggffkgidalpltgqythyalnkktgkpdyvtdsaasatawstgvktyngalgvd
    ihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgnal
    ekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaasl
    nsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaqmt
    dkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegntl
    vivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaayg
    phaanvvgltdqtdlfytmkaalglk