PDB entry 1ur8

View 1ur8 on RCSB PDB site
Description: Interactions of a family 18 chitinase with the designed inhibitor HM508, and its degradation product, chitobiono-delta-lactone
Class: hydrolase
Keywords: hydrolase, chitinase, inhibition, lactone, chitin degradation, glycosidase
Deposited on 2003-10-27, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase b
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ur8a1, d1ur8a2, d1ur8a3
  • Chain 'B':
    Compound: chitinase b
    Species: SERRATIA MARCESCENS [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ur8b1, d1ur8b2, d1ur8b3
  • Heterogens: GOL, SO4, NAG, GDL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ur8A (A:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur8A (A:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ur8B (B:)
    mstrkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlec
    awdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasr
    akfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyq
    ltiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfy
    nalreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvs
    ggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwn
    dktktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldr
    yfnaadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwg
    yitsapgsdsawlkvgrva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur8B (B:)
    trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
    dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
    faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
    iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
    lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfygrafkgvsgg
    nggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqgnygyqrlwndk
    tktpylyhaqnglfvtyddaesfkykakyikqqqlggvmfwhlgqdnrngdllaaldryf
    naadyddsqldmgtglrytgvgpgnlpimtapayvpgttyaqgalvsyqgyvwqtkwgyi
    tsapgsdsawlkvgrva