PDB entry 1ur6

View 1ur6 on RCSB PDB site
Description: nmr based structural model of the ubch5b-cnot4 complex
Class: ligase
Keywords: ubiquitin conjugating enzyme, ubiquitin ligase, ring finger protein, ccr4-not complex, transcription regulation, ligase
Deposited on 2003-10-27, released 2004-05-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-05-07, with a file datestamp of 2007-07-20.
Experiment type: THEORY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -5.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2-17 kda 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ur6a_
  • Chain 'B':
    Compound: potential transcriptional repressor not4hp
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ur6b_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ur6A (A:)
    malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
    pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
    peiariyktdrekynriarewtqkyam
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ur6B (B:)
    vecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpyped