PDB entry 1ur6

View 1ur6 on RCSB PDB site
Description: nmr based structural model of the ubch5b-cnot4 complex
Class: ligase
Keywords: ligase, ubiquitin conjugating enzyme, ubiquitin ligase, ring finger protein, ccr4-not complex, transcription regulation
Deposited on 2003-10-27, released 2004-05-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: THEORY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -5.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ubiquitin-conjugating enzyme e2-17 kda 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51669 (0-146)
  Domains in SCOPe 2.08: d1ur6a_
• Chain 'B':
  Compound: potential transcriptional repressor not4hp
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95628 (0-51)
  Domains in SCOPe 2.08: d1ur6b_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ur6A (A:)
  malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
  pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
  peiariyktdrekynriarewtqkyam
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ur6B (B:)
  vecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpyped