PDB entry 1ur4

View 1ur4 on RCSB PDB site
Description: the structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
Class: hydrolase
Keywords: hydrolase, beta-1, 4-galactanase, glycoside hydrolase, substrate specificity, pectin, gh-a, family 53, plant cell wall degradation
Deposited on 2003-10-24, released 2004-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactanase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • GB AAO31370
    Domains in SCOPe 2.06: d1ur4a_
  • Chain 'B':
    Compound: galactanase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed):
    • GB AAO31370
    Domains in SCOPe 2.06: d1ur4b_
  • Heterogens: PEG, CA, B2G, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ur4A (A:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur4A (A:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ur4B (B:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur4B (B:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpfk