PDB entry 1ur4

View 1ur4 on RCSB PDB site
Description: the structure of endo-beta-1,4-galactanase from bacillus licheniformis in complex with two oligosaccharide products.
Deposited on 2003-10-24, released 2004-10-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-20, with a file datestamp of 2004-10-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.205
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ur4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1ur4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ur4A (A:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur4A (A:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ur4B (B:)
    ahrdsgtaksglyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkea
    gvnyvrvriwndpydangngygggnndlekaiqigkratangmklladfhysdfwadpak
    qkapkawanlnfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakms
    qlfnagsqavretdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgt
    lknltsvltsvadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanav
    rdviqavsdvgeagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpeda
    gkwfggsavdnqalfdfkgrplpslhvfqyvdtgtpfkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur4B (B:)
    glyvekvsglrkdfikgvdvssiialeesgvafynesgkkqdifktlkeagvnyvrvriw
    ndpydangngygggnndlekaiqigkratangmklladfhysdfwadpakqkapkawanl
    nfedkktalyqytkqslkamkaagidigmvqvgnetngglagetdwakmsqlfnagsqav
    retdsnilvalhftnpetsgryawiaetlhrhhvdydvfassyypfwhgtlknltsvlts
    vadtygkkvmvaetsytytaedgdghgntapkngqtlnnpvtvqgqanavrdviqavsdv
    geagigvfywepawipvgpahrleknkalwetygsgwatsyaaeydpedagkwfggsavd
    nqalfdfkgrplpslhvfqyvdtgtpfk