PDB entry 1ur3

View 1ur3 on RCSB PDB site
Description: crystal structure of the apo form of the e.coli ydhf protein
Class: oxidoreductase
Keywords: nadp binding, aldo-keto reductase, oxidoreductase
Deposited on 2003-10-24, released 2003-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.2
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'M':
    Compound: hypothetical oxidoreductase ydhf
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UR3
    • Uniprot P76187 (21-318)
    Domains in SCOPe 2.08: d1ur3m_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1ur3M (M:)
    msyyhhhhhhlestslykkaglvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfie
    ehldlgvttvdhadiyggyqceaafgealklaphlrermeivskcgiattareenvighy
    itdrdhiiksaeqslinlatdhldlllihrpdplmdadevadafkhlhqsgkvrhfgvsn
    ftpaqfallqsrlpftlatnqveispvhqpllldgtldqlqqlrvrpmawsclgggrlfn
    ddyfqplrdelavvaeelnagsieqvvnawvlrlpsqplpiigsgkiervraaveaetlk
    mtrqqwfrirkaalgydvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur3M (M:)
    lvqritiapqgpefsrfvmgywrlmdwnmsarqlvsfieehldlgvttvdhadiyggyqc
    eaafgealklaphlrermeivskcgiattareenvighyitdrdhiiksaeqslinlatd
    hldlllihrpdplmdadevadafkhlhqsgkvrhfgvsnftpaqfallqsrlpftlatnq
    veispvhqpllldgtldqlqqlrvrpmawsclgggrlfnddyfqplrdelavvaeelnag
    sieqvvnawvlrlpsqplpiigsgkiervraaveaetlkmtrqqwfrirkaalgydvp