PDB entry 1ur2

View 1ur2 on RCSB PDB site
Description: Xylanase Xyn10B mutant (E262S) from Cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose
Class: hydrolase
Keywords: hydrolase, family 10, xylanase, glycoside hydrolase, hemicellulose, xylan degradation
Deposited on 2003-10-24, released 2003-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoxylanase
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UR2 (370-End)
      • conflict (35-39)
      • conflict (215)
      • conflict (220-221)
      • conflict (270)
      • conflict (289-290)
      • conflict (341)
      • engineered mutation (261)
    • Uniprot O68541 (Start-369)
    Domains in SCOPe 2.08: d1ur2a1, d1ur2a2
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ur2A (A:)
    mltsagiamgqasklaaatkaaeqtglksaykdnfligaalnatiasgaderlntliake
    fnsitpencmkwgvlrdaqgqwnwkdadafvafgtkhnlhmvghtlvwhsqihdevfkna
    dgsyiskaalqkkmeehittlagrykgklaawdvvneavgddlkmrdshwykimgddfiy
    naftlanevdpkahlmyndyniertgkreatvemierlqkrgmpihglgiqghlgidtpp
    iaeieksiiafaklglrvhftsldvdvlpsvwelpvaevstrfeykperdpytkglpqem
    qdklakryedlfklfikhsdkidratfwgvsddaswlngfpipgrtnypllfdrklqpkd
    ayfrlldlkrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur2A (A:)
    tglksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnw
    kdadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagr
    ykgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndynier
    tgkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsld
    vdvlpsvwelpvaevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidr
    atfwgvsddaswlngfpipgrtnypllfdrklqpkdayfrlldlkrlehhh