PDB entry 1ur1

View 1ur1 on RCSB PDB site
Description: xylanase xyn10b mutant (e262s) from cellvibrio mixtus in complex with arabinofuranose alpha-1,3 linked to xylobiose
Class: hydrolase
Keywords: hydrolase, family 10, xylanase, glycoside hydrolase, hemicellulose, xylan degradation
Deposited on 2003-10-24, released 2003-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.153
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoxylanase
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UR1 (370-End)
      • conflict see remark 9 (35-39)
      • conflict see remark 9 (215)
      • conflict see remark 9 (220-221)
      • conflict see remark 9 (270)
      • conflict see remark 9 (289-290)
      • conflict see remark 9 (341)
      • engineered mutation (261)
    • Uniprot O68541 (Start-369)
    Domains in SCOPe 2.07: d1ur1a1, d1ur1a2
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ur1A (A:)
    mltsagiamgqasklaaatkaaeqtglksaykdnfligaalnatiasgaderlntliake
    fnsitpencmkwgvlrdaqgqwnwkdadafvafgtkhnlhmvghtlvwhsqihdevfkna
    dgsyiskaalqkkmeehittlagrykgklaawdvvneavgddlkmrdshwykimgddfiy
    naftlanevdpkahlmyndyniertgkreatvemierlqkrgmpihglgiqghlgidtpp
    iaeieksiiafaklglrvhftsldvdvlpsvwelpvaevstrfeykperdpytkglpqem
    qdklakryedlfklfikhsdkidratfwgvsddaswlngfpipgrtnypllfdrklqpkd
    ayfrlldlkrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ur1A (A:)
    glksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnwk
    dadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagry
    kgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndyniert
    gkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsldv
    dvlpsvweevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidratfwg
    vsddaswlngfpipgrtnypllfdrklqpkdayfrlldlkrlehhh