PDB entry 1uqz

View 1uqz on RCSB PDB site
Description: xylanase xyn10b mutant (e262s) from cellvibrio mixtus in complex with 4-o-methyl glucuronic acid
Class: hydrolase
Keywords: hydrolase, family 10, xylanase, glycoside hydrolase, hemicellulose, xylan degradation
Deposited on 2003-10-24, released 2003-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.16
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoxylanase
    Species: CELLVIBRIO MIXTUS [TaxId:39650]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UQZ (370-End)
      • conflict see remark 9 (35-39)
      • conflict see remark 9 (215)
      • conflict see remark 9 (220-221)
      • conflict see remark 9 (270)
      • conflict see remark 9 (289-290)
      • conflict see remark 9 (341)
      • engineered mutation (261)
    • Uniprot O68541 (Start-369)
    Domains in SCOPe 2.07: d1uqza1, d1uqza2
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uqzA (A:)
    mltsagiamgqasklaaatkaaeqtglksaykdnfligaalnatiasgaderlntliake
    fnsitpencmkwgvlrdaqgqwnwkdadafvafgtkhnlhmvghtlvwhsqihdevfkna
    dgsyiskaalqkkmeehittlagrykgklaawdvvneavgddlkmrdshwykimgddfiy
    naftlanevdpkahlmyndyniertgkreatvemierlqkrgmpihglgiqghlgidtpp
    iaeieksiiafaklglrvhftsldvdvlpsvwelpvaevstrfeykperdpytkglpqem
    qdklakryedlfklfikhsdkidratfwgvsddaswlngfpipgrtnypllfdrklqpkd
    ayfrlldlkrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqzA (A:)
    glksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnwk
    dadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagry
    kgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndyniert
    gkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsldv
    dvlpsvwelpvaevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidra
    tfwgvsddaswlngfpipgrtnypllfdrklqpkdayfrlldlkrleh