PDB entry 1uqx

View 1uqx on RCSB PDB site
Description: Ralstonia solanacearum lectin (RS-IIL) in complex with alpha-methylmannoside
Class: sugar binding protein
Keywords: lectin, sugar-binding protein, alpha-methyl-mannoside, sugar binding protein
Deposited on 2003-10-22, released 2004-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: RALSTONIA SOLANACEARUM [TaxId:305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uqxa_
  • Heterogens: CA, MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uqxA (A:)
    aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
    aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg