PDB entry 1uqx

View 1uqx on RCSB PDB site
Description: ralstonia solanacearum lectin (rs-iil) in complex with alpha-methylmannoside
Class: sugar binding protein
Keywords: lectin, sugar-binding protein, alpha-methyl-mannoside, sugar binding protein
Deposited on 2003-10-22, released 2004-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.118
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: RALSTONIA SOLANACEARUM [TaxId:305]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqxa_
  • Heterogens: CA, MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uqxA (A:)
    aqqgvftlpantsfgvtafanaantqtiqvlvdnvvkatftgsgtsdkllgsqvlnsgsg
    aikiqvsvngkpsdlvsnqtilanklnfamvgsedgtdndyndgiavlnwplg