PDB entry 1uqw

View 1uqw on RCSB PDB site
Description: crystal structure of ylib protein from escherichia coi
Deposited on 2003-10-22, released 2003-10-22
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-19, with a file datestamp of 2003-11-19.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.199
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uqwa_
  • Chain 'B':
    Domains in SCOP 1.67: d1uqwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uqwA (A:)
    syyhhhhhhlestslykkagafaakdvvvavgsnfttldpydandtlsqavaksfyqglf
    gldkemklknvlaesytvsddgitytvklregikfqdgtdfnaaavkanldrasdpanhl
    krhnlykniakteaidpttvkitlkqpfsafinilahpatamispaalekygkeigfypv
    gtgpyeldtwnqtdfvkvkkfagywqpglpkldsitwrpvadnntraamlqtgeaqfafp
    ipyeqatlleknknielmaspsimqryismnvtqkpfdnpkvrealnyainrpalvkvaf
    agyatpatgvvppsiayaqsykpwpydpvkarellkeagypngfsttlwsshnhstaqkv
    lqftqqqlaqvgikaqvtamdagqraaevegkgqkesgvrmfytgwsastgeadwalspl
    fasqnwpptlfntafysnkqvddflaqalktndpaektrlykaaqdiiwqespwiplvve
    klvsahsknltgfwimpdtgfsfedadlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqwA (A:)
    aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
    itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
    tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
    gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
    imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
    pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
    gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
    dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
    fedadlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uqwB (B:)
    syyhhhhhhlestslykkagafaakdvvvavgsnfttldpydandtlsqavaksfyqglf
    gldkemklknvlaesytvsddgitytvklregikfqdgtdfnaaavkanldrasdpanhl
    krhnlykniakteaidpttvkitlkqpfsafinilahpatamispaalekygkeigfypv
    gtgpyeldtwnqtdfvkvkkfagywqpglpkldsitwrpvadnntraamlqtgeaqfafp
    ipyeqatlleknknielmaspsimqryismnvtqkpfdnpkvrealnyainrpalvkvaf
    agyatpatgvvppsiayaqsykpwpydpvkarellkeagypngfsttlwsshnhstaqkv
    lqftqqqlaqvgikaqvtamdagqraaevegkgqkesgvrmfytgwsastgeadwalspl
    fasqnwpptlfntafysnkqvddflaqalktndpaektrlykaaqdiiwqespwiplvve
    klvsahsknltgfwimpdtgfsfedadlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqwB (B:)
    aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
    itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
    tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
    gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
    imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
    pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
    gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
    dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
    fedadlq