PDB entry 1uqw

View 1uqw on RCSB PDB site
Description: crystal structure of ylib protein from escherichia coi
Class: zn binding protein
Keywords: zn binding protein, transport, lipoprotein, bacterial targets at igs-cnrs, france, bigs, structural genomics
Deposited on 2003-10-22, released 2003-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.199
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative binding protein ylib
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UQW
      • conflict (122)
    • Uniprot P75797 (Start-508)
    Domains in SCOPe 2.07: d1uqwa_
  • Chain 'B':
    Compound: putative binding protein ylib
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UQW
      • conflict (122)
    • Uniprot P75797 (Start-508)
    Domains in SCOPe 2.07: d1uqwb_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uqwA (A:)
    syyhhhhhhlestslykkagafaakdvvvavgsnfttldpydandtlsqavaksfyqglf
    gldkemklknvlaesytvsddgitytvklregikfqdgtdfnaaavkanldrasdpanhl
    krhnlykniakteaidpttvkitlkqpfsafinilahpatamispaalekygkeigfypv
    gtgpyeldtwnqtdfvkvkkfagywqpglpkldsitwrpvadnntraamlqtgeaqfafp
    ipyeqatlleknknielmaspsimqryismnvtqkpfdnpkvrealnyainrpalvkvaf
    agyatpatgvvppsiayaqsykpwpydpvkarellkeagypngfsttlwsshnhstaqkv
    lqftqqqlaqvgikaqvtamdagqraaevegkgqkesgvrmfytgwsastgeadwalspl
    fasqnwpptlfntafysnkqvddflaqalktndpaektrlykaaqdiiwqespwiplvve
    klvsahsknltgfwimpdtgfsfedadlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqwA (A:)
    aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
    itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
    tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
    gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
    imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
    pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
    gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
    dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
    fedadlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uqwB (B:)
    syyhhhhhhlestslykkagafaakdvvvavgsnfttldpydandtlsqavaksfyqglf
    gldkemklknvlaesytvsddgitytvklregikfqdgtdfnaaavkanldrasdpanhl
    krhnlykniakteaidpttvkitlkqpfsafinilahpatamispaalekygkeigfypv
    gtgpyeldtwnqtdfvkvkkfagywqpglpkldsitwrpvadnntraamlqtgeaqfafp
    ipyeqatlleknknielmaspsimqryismnvtqkpfdnpkvrealnyainrpalvkvaf
    agyatpatgvvppsiayaqsykpwpydpvkarellkeagypngfsttlwsshnhstaqkv
    lqftqqqlaqvgikaqvtamdagqraaevegkgqkesgvrmfytgwsastgeadwalspl
    fasqnwpptlfntafysnkqvddflaqalktndpaektrlykaaqdiiwqespwiplvve
    klvsahsknltgfwimpdtgfsfedadlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqwB (B:)
    aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
    itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
    tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
    gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
    imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
    pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
    gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
    dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
    fedadlq