PDB entry 1uqv

View 1uqv on RCSB PDB site
Description: sam domain from ste50p
Deposited on 2003-10-20, released 2003-10-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-15, with a file datestamp of 2004-01-15.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uqva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uqvA (A:)
gshmnnedfsqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcd
gdlnkaikfkilinkmrdsklewkd