PDB entry 1uqv

View 1uqv on RCSB PDB site
Description: sam domain from ste50p
Class: signaling protein
Keywords: sam, sterile alpha motif, helical, protein-protein interaction domain, growth arrest, signaling protein
Deposited on 2003-10-20, released 2003-10-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ste50 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UQV (0-2)
    • Uniprot P25344 (3-84)
    Domains in SCOPe 2.08: d1uqva1, d1uqva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uqvA (A:)
gshmnnedfsqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcd
gdlnkaikfkilinkmrdsklewkd