PDB entry 1uqu

View 1uqu on RCSB PDB site
Description: trehalose-6-phosphate from e. coli bound with udp-glucose.
Class: synthase
Keywords: synthase, glycosyltransferase, transferase
Deposited on 2003-10-20, released 2003-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha, alpha-trehalose-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UQU
    • Uniprot P31677 (1-End)
    Domains in SCOPe 2.07: d1uqua_
  • Chain 'B':
    Compound: alpha, alpha-trehalose-phosphate synthase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UQU
    • Uniprot P31677 (1-End)
    Domains in SCOPe 2.07: d1uqub_
  • Heterogens: UPG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uquA (A:)
    msrlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgn
    itwasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpl
    lqdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdy
    dllgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagp
    lppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiapts
    rgdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtpl
    rdgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltms
    laerisrhaemldvivkndinhwqecfisdlkqivprsaesqqrdkvatfpklalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uquA (A:)
    srlvvvsnriappdsagglavgilgalkaagglwfgwsgetgnedqplkkvkkgnitwas
    fnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpllqddd
    iiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdydllgf
    qtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagplppkl
    aqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsrgdvq
    ayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplrdgmn
    lvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmslaeri
    srhaemldvivkndinhwqecfisdlkqivpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uquB (B:)
    msrlvvvsnriappdehaasagglavgilgalkaagglwfgwsgetgnedqplkkvkkgn
    itwasfnlseqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpl
    lqdddiiwihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdy
    dllgfqtendrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagp
    lppklaqlkaelknvqnifsverldyskglperflayeallekypqhhgkirytqiapts
    rgdvqayqdirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtpl
    rdgmnlvakeyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltms
    laerisrhaemldvivkndinhwqecfisdlkqivprsaesqqrdkvatfpklalehhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uquB (B:)
    srlvvvsnriapagglavgilgalkaagglwfgwsgetgnedqplkkvkkgnitwasfnl
    seqdldeyynqfsnavlwpafhyrldlvqfqrpawdgylrvnalladkllpllqdddiiw
    ihdyhllpfahelrkrgvnnrigfflhipfptpeifnalptydtlleqlcdydllgfqte
    ndrlafldclsnltrvttrsakshtawgkafrtevypigiepkeiakqaagplppklaql
    kaelknvqnifsverldyskglperflayeallekypqhhgkirytqiaptsrgdvqayq
    dirhqleneagringkygqlgwtplyylnqhfdrkllmkifrysdvglvtplrdgmnlva
    keyvaaqdpanpgvlvlsqfagaaneltsalivnpydrdevaaaldraltmslaerisrh
    aemldvivkndinhwqecfisdlkqivpr