PDB entry 1uqr

View 1uqr on RCSB PDB site
Description: type II 3-dehydroquinate dehydratase (dhqase) from actinobacillus pleuropneumoniae
Class: lyase
Keywords: shikimate pathway, aromatic amino acid biosynthesis, lyase
Deposited on 2003-10-16, released 2003-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqra_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrb_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrc_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrd_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqre_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrf_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrg_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrh_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqri_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrk_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Actinobacillus pleuropneumoniae [TaxId:715]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uqrl_
  • Heterogens: SO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uqrA (A:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrA (A:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uqrB (B:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrB (B:)
    mkkilllngpnlnmlgkqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqafqnt
    dfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvicglg
    akgydyaldfaiselqki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uqrC (C:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrC (C:)
    mkkilllngpnlnmlgkrsqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqafq
    ntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvicg
    lgakgydyaldfaiselqkiqlgemmng
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uqrD (D:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrD (D:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uqrE (E:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrE (E:)
    mkkilllngpnlnmlgkriygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihq
    afqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgv
    icglgakgydyaldfaiselqki
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uqrF (F:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrF (F:)
    mkkilllngpnlnmlgkrsqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqafq
    ntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvicg
    lgakgydyaldfaiselqkiqlgemm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1uqrG (G:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrG (G:)
    mkkilllngpnlnmlgkrsqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqafq
    ntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvicg
    lgakgydyaldfaiselqki
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uqrH (H:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrH (H:)
    mkkilllngpnlnmlgkrsqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqafq
    ntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvicg
    lgakgydyaldfaiselqkiqlgemmng
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1uqrI (I:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrI (I:)
    mkkilllngpnlnmlgkresqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqaf
    qntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvic
    glgakgydyaldfaiselqki
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1uqrJ (J:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrJ (J:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqki
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1uqrK (K:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrK (K:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1uqrL (L:)
    mkkilllngpnlnmlgkrephiygsqtlsdieqhlqqsaqaqgyeldyfqangeeslinr
    ihqafqntdfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdva
    kgvicglgakgydyaldfaiselqkiqlgemmng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uqrL (L:)
    mkkilllngpnlnmlgkqtlsdieqhlqqsaqaqgyeldyfqangeeslinrihqafqnt
    dfiiinpgafthtsvairdallavsipfievhlsnvharepfrhhsylsdvakgvicglg
    akgydyaldfaiselqki