PDB entry 1upx

View 1upx on RCSB PDB site
Description: the crystal structure of the hybrid cluster protein from desulfovibrio desulfuricans containing molecules in the oxidized and reduced states.
Class: oxidoreductase
Keywords: oxidoreductase, hybrid cluster, reduced iron-sulfur, oxidized iron-sulfur
Deposited on 2003-10-14, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.14
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hydroxylamine reductase
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upxa_
  • Chain 'B':
    Compound: hydroxylamine reductase
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upxb_
  • Heterogens: SF4, SF3, FSO, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upxA (A:)
    snamfcyqcqetvgnkgctqvgvcgkkpetaalqdaliyvtkglgqiatrlraegkavdh
    ridrlvtgnlfatitnanfdddilaervrmtcaakkelaasltdksglsdaalweaseks
    amlakagtvgvmattdddvrslrwlitfglkgmaayakhadvlgkhensldafmqealak
    tlddslsvadlvaltletgkfgvsamalldaantgtyghpeitkvnigvgsnpgilisgh
    dlrdlemllkqtegtgvdvythsemlpahyypafkkyahfkgnygnawwkqkeefesfng
    pvllttnclvppkdsykdrvyttgivgftgckhipgeigehkdfsaiiahaktcpaptei
    esgeiiggfahnqvlaladkvidavksgaikkfvvmagcdgraksrsyytdfaeglpkdt
    viltagcakyrynklnlgdiggiprvldagqcndsyslavialklkevfgledvndlpiv
    yniawyeqkavivllallslgvknihlgptlpaflspnvakvlveqfniggitspqddlk
    affg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upxB (B:)
    snamfcyqcqetvgnkgctqvgvcgkkpetaalqdaliyvtkglgqiatrlraegkavdh
    ridrlvtgnlfatitnanfdddilaervrmtcaakkelaasltdksglsdaalweaseks
    amlakagtvgvmattdddvrslrwlitfglkgmaayakhadvlgkhensldafmqealak
    tlddslsvadlvaltletgkfgvsamalldaantgtyghpeitkvnigvgsnpgilisgh
    dlrdlemllkqtegtgvdvythsemlpahyypafkkyahfkgnygnawwkqkeefesfng
    pvllttnclvppkdsykdrvyttgivgftgckhipgeigehkdfsaiiahaktcpaptei
    esgeiiggfahnqvlaladkvidavksgaikkfvvmagcdgraksrsyytdfaeglpkdt
    viltagcakyrynklnlgdiggiprvldagqcndsyslavialklkevfgledvndlpiv
    yniawyeqkavivllallslgvknihlgptlpaflspnvakvlveqfniggitspqddlk
    affg