PDB entry 1upu

View 1upu on RCSB PDB site
Description: structure of the uracil phosphoribosyltransferase, mutant c128v, bound to product uridine-1-monophosphate (ump)
Deposited on 1998-04-16, released 1999-05-11
The last revision prior to the SCOP 1.61 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.148
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1upua_
  • Chain 'B':
    Domains in SCOP 1.61: d1upub_
  • Chain 'C':
    Domains in SCOP 1.61: d1upuc_
  • Chain 'D':
    Domains in SCOP 1.61: d1upud_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuA (A:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuB (B:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuC (C:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upuD (D:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm