PDB entry 1upt

View 1upt on RCSB PDB site
Description: Structure of a complex of the golgin-245 GRIP domain with Arl1
Class: hydrolase/protein-binding
Keywords: HYDROLASE/PROTEIN-BINDING, COMPLEX (GTPASE-GOLGIN), GOLGIN-245, GRIP, ARL1, GOLGIN, GTPASE, G-PROTEIN, GOLGI, GRIP DIMER, PROTEIN SORTING, VESICLE TRAFFICKING, HYDROLASE-PROTEIN-BINDING complex
Deposited on 2003-10-12, released 2003-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT (Start-3)
    • Uniprot P40616 (4-170)
    Domains in SCOPe 2.07: d1upta_
  • Chain 'B':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT
      • variant see remark 99 (53-59)
    • Uniprot Q13439 (Start-59)
    Domains in SCOPe 2.07: d1uptb_
  • Chain 'C':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uptc_
  • Chain 'D':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT
    • Uniprot Q13439 (1-End)
    Domains in SCOPe 2.07: d1uptd_
  • Chain 'E':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT (Start-3)
    • Uniprot P40616 (4-End)
    Domains in SCOPe 2.07: d1upte_
  • Chain 'F':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT
      • variant see remark 99 (53-57)
    • Uniprot Q13439
    Domains in SCOPe 2.07: d1uptf_
  • Chain 'G':
    Compound: ADP-ribosylation factor-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT (0-3)
    • Uniprot P40616 (4-End)
    Domains in SCOPe 2.07: d1uptg_
  • Chain 'H':
    Compound: Golgi autoantigen, golgin subfamily A member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPT
    • Uniprot Q13439 (1-End)
    Domains in SCOPe 2.07: d1upth_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uptA (A:)
    gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
    ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
    eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptA (A:)
    hmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgglt
    sirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeq
    amtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uptB (B:)
    mgeptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptB (B:)
    eptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uptC (C:)
    gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
    ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
    eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptC (C:)
    mrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggltsirpy
    wrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamtss
    emanslglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uptD (D:)
    mgeptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptD (D:)
    geptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uptE (E:)
    gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
    ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
    eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptE (E:)
    hmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgglt
    sirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeq
    amtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uptF (F:)
    mgeptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptF (F:)
    eptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1uptG (G:)
    gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
    ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
    eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptG (G:)
    gshmtremrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlgg
    ltsirpywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdm
    eqamtssemanslglpalkdrkwqifktsatkgtgldeamewlvetlksr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1uptH (H:)
    mgeptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmswlrsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uptH (H:)
    geptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarl