PDB entry 1upr

View 1upr on RCSB PDB site
Description: Crystal structure of the PEPP1 pleckstrin homology domain in complex with Inositol 1,3,4,5-tetrakisphosphate
Class: signaling protein
Keywords: signaling protein, signal transduction, phosphoinositide binding domain
Deposited on 2003-10-10, released 2004-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-07, with a file datestamp of 2016-12-02.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pleckstrin homology domain-containing family a member 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upra_
  • Heterogens: 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uprA (A:)
    nalrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsy
    nirpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasraegddygqprs
    par
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uprA (A:)
    lrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsyni
    rpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasr