PDB entry 1upq

View 1upq on RCSB PDB site
Description: Crystal structure of the pleckstrin homology (PH) domain of PEPP1
Class: signal transduction
Keywords: ph domain, phosphoinositide binding, signal transduction
Deposited on 2003-10-09, released 2004-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepp1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1upqa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upqA (A:)
    nalrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsy
    nirpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasraegddygqprs
    par
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upqA (A:)
    lrrdpnlpvhirgwlhkqdssglrlwkrrwfvlsghclfyykdsreesvlgsvllpsyni
    rpdgpgaprgrrftftaehpgmrtyvlaadtledlrgwlralgrasr