PDB entry 1upn

View 1upn on RCSB PDB site
Description: complex of echovirus type 12 with domains 3 and 4 of its receptor decay accelerating factor (cd55) by cryo electron microscopy at 16 a
Class: virus/receptor
Keywords: virus/receptor, complex (virus coat-immune protein), echovirus, picornavirus, cd55, daf, virus-receptor complex, icosahedral virus
Deposited on 2003-10-08, released 2004-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: EM
Resolution: 16 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: echovirus 11 coat protein vp1
    Species: HUMAN ECHOVIRUS 11 [TaxId:12078]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upna_
  • Chain 'B':
    Compound: echovirus 11 coat protein vp2
    Species: HUMAN ECHOVIRUS 11 [TaxId:12078]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8JKE8
      • conflict (225)
    Domains in SCOPe 2.07: d1upn.1
  • Chain 'C':
    Compound: echovirus 11 coat protein vp3
    Species: HUMAN ECHOVIRUS 11 [TaxId:12078]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8JKE8 (0-237)
      • conflict (62)
    Domains in SCOPe 2.07: d1upnc_
  • Chain 'D':
    Compound: echovirus 11 coat protein vp4
    Species: HUMAN ECHOVIRUS 11 [TaxId:12078]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upn.1
  • Chain 'E':
    Compound: complement decay-accelerating factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1upne1, d1upne2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upnA (A:)
    gdvveavenavarvadtigsgpsnsqavpaltavetghtsqvtpsdtvqtrhvknyhsrs
    essienflsrsacvymgeyhttnsdqtklfaswtisarrmvqmrrkleiftyvrfdvevt
    fvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnappr
    msipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyf
    kpkhvkawvprpprlcqyknastvnfsptditdkrnsityipdtvkpdvsnh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upnA (A:)
    gdvveavenavarvadtigsgpsnsqavpaltavetghtsqvtpsdtvqtrhvknyhsrs
    essienflsrsacvymgeyhttnsdqtklfaswtisarrmvqmrrkleiftyvrfdvevt
    fvitskqdqgtqlgqdmpplthqimyippggpipksvtdytwqtstnpsifwtegnappr
    msipfisignaysnfydgwshfsqngvygyntlnhmgqiyvrhvngssplpmtstvrmyf
    kpkhvkawvprpprlcqyknastvnfsptditdkrnsityipdtvkpdv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1upnB (B:)
    spsaeecgysdrvrsitlgnstittqesanvvvgygrwpeylrddeataedqptqpdvat
    crfytlesvtwekdspgwwwkfpdalkdmglfgqnmyyhylgragytihvqcnaskfhqg
    cllvvcvpeaemgcstvdgtvnehglsegetakkfsatgtngtntvqsivtnagmgvgvg
    nltifphqwinlrtnncativmpyinnvpmdnmfrhhnftlmiipfvplnyssdfstyvp
    itvtvapmcaeynglrlstalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upnB (B:)
    sdrvrsitlgnstittqesanvvvgygrwpeylrddeataedqptqpdvatcrfytlesv
    twekdspgwwwkfpdalkdmglfgqnmyyhylgragytihvqcnaskfhqgcllvvcvpe
    aemgcstvdgtvnehglsegetakkfsatgtngtntvqsivtnagmgvgvgnltifphqw
    inlrtnncativmpyinnvpmdnmfrhhnftlmiipfvplnyssdfstyvpitvtvapmc
    aeynglrlstal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upnC (C:)
    glpvintpgsnqfltsddfqspsampqfdvtpelnipgevqnlmeiaevdsvvpvnnvag
    nletmdiyripvqsgnhqssqvfgfqvqpgldgvfkhtllgeilnyyahwsgsikltfvf
    cgsamatgkfllayappganapksrkdamlgthiiwdvglqsscvlcipwisqthyrlvq
    qdeytsagnvtcwyqtgivvpagtptscsimcfvsacndfsvrllkdtpfiqqaallq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1upnD (D:)
    mgaqvstqktgahetglrasgnsiihytninyykdaasnsanrqdftqdpgkftepvkdi
    mvkslpaln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upnD (D:)
    gaqvstqktgahesiihytninyykdaasnsanrqdftqdpgkftepvkdimvkslpaln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1upnE (E:)
    fckkkscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdp
    lpecreiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegew
    sgpppecrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upnE (E:)
    kscpnpgeirngqidvpggilfgatisfscntgyklfgstssfclisgssvqwsdplpec
    reiycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpp
    pecrg