PDB entry 1upk

View 1upk on RCSB PDB site
Description: crystal structure of mo25 in complex with a c-terminal peptide of strad
Deposited on 2003-10-07, released 2004-01-22
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-22, with a file datestamp of 2004-01-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1upka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upkA (A:)
    mpfpfgkshkspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnek
    epqteavaqlaqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyi
    ctqqnilfmllkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdi
    asdafatfkdlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldr
    hnftimtkyiskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqa
    klieflskfqndrtedeqfndektylvkqirdlkrpaqqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upkA (A:)
    kspadivknlkesmavleksdkkaekateevsknlvamkeilyqteavaqlaqelynsgl
    lstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmllkgyespei
    alncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdlltrhklls
    aefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyiskpenlklm
    mnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqndredeqfn
    dektylvkqirdlkrpaqq