PDB entry 1upi

View 1upi on RCSB PDB site
Description: Mycobacterium tuberculosis rmlC epimerase (Rv3465)
Class: epimerase
Keywords: epimerase, rhamnose pathway, psi, protein structure initiative, tb structural genomics consortium, tb, tbsgc
Deposited on 2003-10-05, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-24, with a file datestamp of 2017-05-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: MYCOBACTERIUM TUBERCULOSIS [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPI
    • Uniprot O06330 (20-End)
    Domains in SCOPe 2.07: d1upia_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upiA (A:)
    mgsshhhhhhssglvprgshmkareldvpgaweitptihvdsrglffewltdhgfrafag
    hsldvrqvncsvssagvlrglhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwds
    vllddqdrrtiyvseglahgflalqdnstvmylcsaeynpqrehticatdptlavdwplv
    dgaapslsdrdaaapsfedvrasgllprweqtqrfigemrgtgsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upiA (A:)
    mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
    lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
    flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
    rasgllprweqtqrfigemrg