PDB entry 1uph

View 1uph on RCSB PDB site
Description: hiv-1 myristoylated matrix
Class: virus/viral protein
Keywords: virus/viral protein, myristyl, myristoylated, post-translational modification, myristyl switch, polyprotein, phosphorylation
Deposited on 2003-10-01, released 2004-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 (CLONE 12) [TaxId:11679]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UPH (0-0)
    • Uniprot P12493 (1-131)
    Domains in SCOPe 2.07: d1upha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uphA (A:)
    xgarasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqi
    lgqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaa
    dtgnnsqvsqny