PDB entry 1upg

View 1upg on RCSB PDB site
Description: crystal structure of the quorum-sensing protein tram from agrobacterium tumefaciens
Deposited on 2003-09-30, released 2004-05-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-10, with a file datestamp of 2004-06-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1upga_
  • Chain 'B':
    Domains in SCOP 1.71: d1upgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upgA (A:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlysilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upgA (A:)
    velrpligltrglpptdletitidairthrrlvekadelfqalpetyktgqacggpqhir
    yieasiemhaqmsalntlysilgfipkvvvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1upgB (B:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlysilgfipkvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upgB (B:)
    meledanvtkkvelrpligltrglpptdletitidairthrrlvekadelfqalpetykt
    gqacggpqhiryieasiemhaqmsalntlysilgfipkvv