PDB entry 1upf

View 1upf on RCSB PDB site
Description: structure of the uracil phosphoribosyltransferase, mutant c128v bound to the drug 5-fluorouracil
Class: transferase
Keywords: transferase, glycosyltransferase, phosphoribosyltransferase
Deposited on 1998-06-17, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.166
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.07: d1upfa_
  • Chain 'B':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.07: d1upfb_
  • Chain 'C':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.07: d1upfc_
  • Chain 'D':
    Compound: uracil phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26998 (0-223)
      • conflict (63)
      • engineered (107)
      • conflict (136)
    Domains in SCOPe 2.07: d1upfd_
  • Heterogens: SO4, URF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upfA (A:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upfB (B:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upfC (C:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1upfD (D:)
    qeesilqdiitrfpnvvlmkqtaqlrammtiirdketpkeefvfyadrlirllieealne
    lpfqkkevttpldvsyhgvsfyskicgvsivragesmesglravcrgvrigkiliqrdet
    taepkliyeklpadirerwvmlldpmcatagsvckaievllrlgvkeeriifvnilaapq
    giervfkeypkvrmvtaavdiclnsryyivpgigdfgdryfgtm