PDB entry 1upd

View 1upd on RCSB PDB site
Description: Oxidized STRUCTURE OF CYTOCHROME C3 FROM DESULFOVIBRIO DESULFURICANS ATCC 27774 AT PH 7.6
Class: electron transport
Keywords: electron transport, tetraheme cytochrome c
Deposited on 2003-09-29, released 2004-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.1469
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L915 (0-106)
      • conflict (70)
    Domains in SCOPe 2.07: d1upda_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1updA (A:)
    apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
    ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp