PDB entry 1upc

View 1upc on RCSB PDB site
Description: carboxyethylarginine synthase from streptomyces clavuligerus
Class: synthase
Keywords: synthase, clavulanic acid, antibiotic, lactamase, flavoprotein, thiamine pyrophosphate
Deposited on 2003-09-29, released 2003-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.178
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1upca1, d1upca2, d1upca3
  • Chain 'B':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1upcb1, d1upcb2, d1upcb3
  • Chain 'C':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1upcc1, d1upcc2, d1upcc3
  • Chain 'D':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1upcd1, d1upcd2, d1upcd3
  • Chain 'E':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1upce1, d1upce2, d1upce3
  • Chain 'F':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1upcf1, d1upcf2, d1upcf3
  • Heterogens: TPP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upcA (A:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upcA (A:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpak
    pvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyia
    kgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiek
    ktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefla
    dpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsa
    gcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtn
    glielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpf
    lievpvnydfqpggfgals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1upcB (B:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upcB (B:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpak
    pvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyia
    kgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiek
    ktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefla
    dpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsa
    gcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtn
    glielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpf
    lievpvnydfqpggfgals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1upcC (C:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upcC (C:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidnppantpakpv
    gvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakg
    vlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekkt
    vrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefladp
    etyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsagc
    ssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtngl
    ielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfli
    evpvnydfqpggfgals
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1upcD (D:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upcD (D:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpak
    pvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyia
    kgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiek
    ktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefla
    dpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsa
    gcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtn
    glielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpf
    lievpvnydfqpggfgals
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1upcE (E:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upcE (E:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidpnppantpakp
    vgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiak
    gvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekk
    tvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
    petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
    cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
    lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
    ievpvnydfqpggfgals
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1upcF (F:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upcF (F:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidpnppantpakp
    vgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiak
    gvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekk
    tvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
    petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
    cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
    lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
    ievpvnydfqpggfgals