PDB entry 1upb

View 1upb on RCSB PDB site
Description: carboxyethylarginine synthase from streptomyces clavuligerus
Class: synthase
Keywords: synthase, clavulanic acid, antibiotic, lactamase, flavoprotein thiamine pyrophosphate
Deposited on 2003-09-29, released 2003-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.159
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1upba1, d1upba2, d1upba3
  • Chain 'B':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1upbb1, d1upbb2, d1upbb3
  • Chain 'C':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1upbc1, d1upbc2, d1upbc3
  • Chain 'D':
    Compound: carboxyethylarginine synthase
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1upbd1, d1upbd2, d1upbd3
  • Heterogens: TPP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1upbA (A:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upbA (A:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtnppantpakp
    vgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiak
    gvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekk
    tvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
    petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
    cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
    lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
    ievpvnydfqpggfgals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1upbB (B:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upbB (B:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpak
    pvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyia
    kgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiek
    ktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefla
    dpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsa
    gcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtn
    glielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpf
    lievpvnydfqpggfgals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1upbC (C:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upbC (C:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidppantpakpvg
    vvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgv
    lpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktv
    risptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaefladpe
    tyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsagcs
    sfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtngli
    elyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpflie
    vpvnydf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1upbD (D:)
    msrvstapsgkptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrhefta
    gvaadvlaritgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndth
    qcldsvaivapmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegid
    ttvpnppantpakpvgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairala
    erlnipvittyiakgvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyae
    dlrpsmwqkgiekktvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhd
    ieplrariaefladpetyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlf
    aradqpfgfltsagcssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarln
    lpivtvvvnndtnglielyqnighhrshdpavkfggvdfvalaeangvdatratnreell
    aalrkgaelgrpflievpvnydfqpggfgalsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1upbD (D:)
    ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
    grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
    mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtnppantpakp
    vgvvadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiak
    gvlpvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekk
    tvrisptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
    petyedgmrvhqvidsmntvmeeaaepgegtivsdigffrhygvlfaradqpfgfltsag
    cssfgygipaaigaqmarpdqptfliagdggfhsnssdletiarlnlpivtvvvnndtng
    lielyqnighhrshdpavkfggvdfvalaeangvdatratnreellaalrkgaelgrpfl
    ievpvnydfqpggfgals