PDB entry 1up9

View 1up9 on RCSB PDB site
Description: reduced structure of cytochrome c3 from desulfovibrio desulfuricans atcc 27774 at ph 7.6
Class: electron transport
Keywords: electron transport, tetraheme cytochrome c
Deposited on 2003-09-29, released 2004-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L915 (0-106)
      • conflict (70)
    Domains in SCOPe 2.08: d1up9a_
  • Heterogens: HEC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1up9A (A:)
    apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
    ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp