PDB entry 1up8

View 1up8 on RCSB PDB site
Description: recombinant vanadium-dependent bromoperoxidase from red algae corallina pilulifera
Class: haloperoxidase
Keywords: haloperoxidase, vanadate
Deposited on 2003-09-29, released 2003-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vanadium-dependent bromoperoxidase 1
    Species: CORALLINA PILULIFERA [TaxId:78447]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81959 (Start-597)
      • see remark 999 (421)
    Domains in SCOPe 2.07: d1up8a_
  • Chain 'B':
    Compound: vanadium-dependent bromoperoxidase 1
    Species: CORALLINA PILULIFERA [TaxId:78447]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81959 (Start-597)
      • see remark 999 (421)
    Domains in SCOPe 2.07: d1up8b_
  • Chain 'C':
    Compound: vanadium-dependent bromoperoxidase 1
    Species: CORALLINA PILULIFERA [TaxId:78447]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81959 (Start-597)
      • see remark 999 (421)
    Domains in SCOPe 2.07: d1up8c_
  • Chain 'D':
    Compound: vanadium-dependent bromoperoxidase 1
    Species: CORALLINA PILULIFERA [TaxId:78447]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O81959 (Start-597)
      • see remark 999 (421)
    Domains in SCOPe 2.07: d1up8d_
  • Heterogens: PO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up8A (A:)
    mgipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasft
    kglphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslel
    evrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefds
    pknaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpyls
    qyiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvf
    ldvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlp
    fqqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnk
    iaaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfh
    psygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnkla
    dniaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up8A (A:)
    gipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasftk
    glphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslele
    vrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefdsp
    knaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpylsq
    yiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvfl
    dvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlpf
    qqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnki
    aaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfhp
    sygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnklad
    niaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1up8B (B:)
    mgipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasft
    kglphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslel
    evrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefds
    pknaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpyls
    qyiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvf
    ldvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlp
    fqqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnk
    iaaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfh
    psygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnkla
    dniaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up8B (B:)
    gipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasftk
    glphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslele
    vrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefdsp
    knaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpylsq
    yiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvfl
    dvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlpf
    qqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnki
    aaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfhp
    sygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnklad
    niaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1up8C (C:)
    mgipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasft
    kglphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslel
    evrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefds
    pknaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpyls
    qyiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvf
    ldvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlp
    fqqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnk
    iaaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfh
    psygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnkla
    dniaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up8C (C:)
    gipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasftk
    glphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslele
    vrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefdsp
    knaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpylsq
    yiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvfl
    dvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlpf
    qqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnki
    aaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfhp
    sygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnklad
    niaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1up8D (D:)
    mgipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasft
    kglphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslel
    evrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefds
    pknaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpyls
    qyiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvf
    ldvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlp
    fqqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnk
    iaaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfh
    psygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnkla
    dniaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up8D (D:)
    gipadnlqsrakasfdtrvaaaelalnrgvvpsfangeellyrnpdpdntdpsfiasftk
    glphddngaiidpddflafvrainsgdekeiadltlgpardpetglpiwrsdlanslele
    vrgwenssagltfdlegpdaqsiamppapvltspelvaeiaelylmalgreiefsefdsp
    knaeyiqfaidqlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpylsq
    yiivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvfl
    dvqdaadfrgfesyepgarlirtirdlatwvhfdalyeaylnaclillangvpfdpnlpf
    qqedkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnki
    aaqkgesifpevdlaveelgdilekaeisnrkqniadgdpdpdpsfllpmafaegspfhp
    sygsghavvagacvtilkaffdsgieidqvfevdkdedklvkssfkgtltvagelnklad
    niaigrnmagvhyfsdqfeslllgeqvaigileeqsltygenfffnlpkfdgttiqi