PDB entry 1up7

View 1up7 on RCSB PDB site
Description: Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.4 Angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate
Class: hydrolase
Keywords: hydrolase, 6-phospho-beta-glucosidase, family4 hydrolase, nad dependent
Deposited on 2003-09-29, released 2004-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7 (0-1)
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7a1, d1up7a2
  • Chain 'B':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7b1, d1up7b2
  • Chain 'C':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7c1, d1up7c2
  • Chain 'D':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7d1, d1up7d2
  • Chain 'E':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7e1, d1up7e2
  • Chain 'F':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7f1, d1up7f2
  • Chain 'G':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7g1, d1up7g2
  • Chain 'H':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP7
    • Uniprot Q9X108 (2-416)
    Domains in SCOPe 2.07: d1up7h1, d1up7h2
  • Heterogens: NAD, G6P, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up7A (A:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7A (A:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklkipdedfptwfydsvrlivnpy
    lryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahl
    irdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfiha
    vkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1up7B (B:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7B (B:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdle
    tdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmye
    rltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1up7C (C:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7C (C:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdle
    tdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmye
    rltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1up7D (D:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7D (D:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkldedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdle
    tdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmye
    rltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1up7E (E:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7E (E:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvrfkvlis
    dtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpivee
    yvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfarledv
    flkyyglnhlsfiekvfvkgedvtekvfenlkldedfptwfydsvrlivnpylryylmek
    kmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdletde
    gkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerlt
    ieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1up7F (F:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7F (F:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkpdedfptwfydsvrlivnpylry
    ylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlird
    letdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkm
    yerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1up7G (G:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7G (G:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahlirdle
    tdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmye
    rltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1up7H (H:)
    rhmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfk
    vlisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafp
    iveeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsa
    rledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrliv
    npylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaa
    ahlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsf
    ihavkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up7H (H:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlkledfptwfydsvrlivnpylryylm
    ekkmfkkisthelrarevmkiekelfekyrtaveipeeltrggsmystaaahlirdletd
    egkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerl
    tieaylkrskklalkallshplgpdvedakdlleeileanreyvklg