PDB entry 1up6

View 1up6 on RCSB PDB site
Description: Structure of the 6-phospho-beta glucosidase from Thermotoga maritima at 2.55 Angstrom resolution in the tetragonal form with manganese, NAD+ and glucose-6-phosphate
Class: hydrolase
Keywords: hydrolase, 6-phospho-beta-glucosidase, family4 hydrolase, nad dependent
Deposited on 2003-09-29, released 2004-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6 (0-0)
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6a1, d1up6a2
  • Chain 'B':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6 (0-0)
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6b1, d1up6b2
  • Chain 'C':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6 (0-0)
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6c1, d1up6c2
  • Chain 'D':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6d1, d1up6d2
  • Chain 'E':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6e1, d1up6e2
  • Chain 'F':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6f1, d1up6f2
  • Chain 'G':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6g1, d1up6g2
  • Chain 'H':
    Compound: 6-phospho-beta-glucosidase
    Species: THERMOTOGA MARITIMA, synthetic [TaxId:243274]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP6
    • Uniprot Q9X108 (1-415)
    Domains in SCOPe 2.08: d1up6h1, d1up6h2
  • Heterogens: NAD, MN, G6P, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up6A (A:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6A (A:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklpdedfptwfydsvrlivnpyl
    ryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaahli
    rdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihav
    kmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1up6B (B:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6B (B:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklipdedfptwfydsvrlivnpy
    lryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltsmystaaahlirdl
    etdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmy
    erltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1up6C (C:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6C (C:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlkldedfptwfydsvrlivnpylryy
    lmekkmfkkisthelrarevmkiekelfekyrtaveipeeltgsmystaaahlirdletd
    egkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerl
    tieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1up6D (D:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6D (D:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklpdedfptwfydsvrlivnpylryy
    lmekkmfkkisthelrarevmkiekelfekyrtaveipegsmystaaahlirdletdegk
    ihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltie
    aylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1up6E (E:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6E (E:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfkrlvrfkvlisd
    tfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiveey
    vdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarledv
    flkyyglnhlsfiekvfvkgedvtekvfenlkdedfptwfydsvrlivnpylryylmekk
    mfkkisthelrarevmkiekelfekpeelstaaahlirdletdegkihivntrnngsien
    lpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltieaylkrskklalkal
    lshplgpdvedakdlleeileanreyvklg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1up6F (F:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6F (F:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklkedfptwfydsvrlivnpylryyl
    mekkmfkkisthelrarevmkiekelfekyrtaveipestaaahlirdletdegkihivn
    trnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltieaylkr
    skklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1up6G (G:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6G (G:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
    eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarl
    edvflkyyglnhlsfiekvfvkgedvtekvfenlklklsdfptwfydsvrlivnpylryy
    lmekkmfkkisthelrarevmkiekelfekyrtaveipeesmystaaahlirdletdegk
    ihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltie
    aylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1up6H (H:)
    hmriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkv
    lisdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpi
    veeyvdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsar
    ledvflkyyglnhlsfiekvfvkgedvtekvfenlklklsnipdedfptwfydsvrlivn
    pylryylmekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmystaaa
    hlirdletdegkihivntrnngsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfi
    havkmyerltieaylkrskklalkallshplgpdvedakdlleeileanreyvklg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up6H (H:)
    mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
    isdtfegavvyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiveey
    vdtvrktsnativnftnpsghitefvrnyleyekfiglcnvpinfireiaemfsarledv
    flkyyglnhlsfiekvfvkgedvtekvfenlkledfptwfydsvrlivnpylryylmekk
    mfkkisthelrarevmkiekelfekyrtaveipestaaahlirdletdegkihivntrnn
    gsienlpddyvleipcyvrsgrvhtlsqgkgdhfalsfihavkmyerltieaylkrskkl
    alkallshplgpdvedakdlleeileanreyvklg