PDB entry 1up3

View 1up3 on RCSB PDB site
Description: structure of the endoglucanase cel6 from mycobacterium tuberculosis in complex with methyl-cellobiosyl-4-deoxy-4-thio-beta-d-cellobioside at 1.6 angstrom
Deposited on 2003-09-26, released 2004-11-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-18, with a file datestamp of 2004-11-18.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.13963
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1up3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up3A (A:)
    manplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvary
    tgaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepd
    alamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvg
    rargfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgra
    lgappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up3A (A:)
    anplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvaryt
    gaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepda
    lamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvgr
    argfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgral
    gappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq