PDB entry 1up2

View 1up2 on RCSB PDB site
Description: Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, family 6
Deposited on 2003-09-26, released 2004-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cela1 protein
    Species: MYCOBACTERIUM TUBERCULOSIS, synthetic [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UP2
    • Uniprot Q79G13 (1-293)
    Domains in SCOPe 2.07: d1up2a_
  • Heterogens: IFM, BGC, SO4, ACT, 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1up2A (A:)
    manplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvary
    tgaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepd
    alamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvg
    rargfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgra
    lgappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up2A (A:)
    anplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvaryt
    gaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepda
    lamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvgr
    argfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgral
    gappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq