PDB entry 1up1

View 1up1 on RCSB PDB site
Description: up1, the two rna-recognition motif domain of hnrnp a1
Deposited on 1997-03-12, released 1997-09-17
The last revision prior to the SCOP 1.55 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.197
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1up1_ (-)
    pkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatve
    evdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfe
    qygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkals
    

    Sequence, based on observed residues (ATOM records): (download)
    >1up1_ (-)
    pkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatve
    evdaamnarphkvdgrvvepkravsrgahltvkkifvggikedteehhlrdyfeqygkie
    vieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkals