PDB entry 1uoz

View 1uoz on RCSB PDB site
Description: structure of the endoglucanase cel6 from mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom
Deposited on 2003-09-26, released 2004-11-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-18, with a file datestamp of 2004-11-18.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.11319
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uoza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uozA (A:)
    mghhhhhhhhhhssghiegrhmanplagkpfyvdpasaamvaarnanppnaeltsvantp
    qsywldqafppatvggtvarytgaaqaagampvltlygiphrdcgsyasggfatgtdyrg
    widavasglgsspatiivepdalamadclspdqrqerfdlvryavdtltrdpaaavyvda
    ghsrwlsaeamaarlndvgvgrargfslnvsnfyttdeeigygeaisgltngshyvidts
    rngagpapdaplnwcnpsgralgappttatagahadaylwikrpgesdgtcgrgepqagr
    fvsqyaidlahnagq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uozA (A:)
    ghiegrhanplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvg
    gtvarytgaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspat
    iivepdalamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarl
    ndvgvgrargfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwc
    npsgralgappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq