PDB entry 1uoz

View 1uoz on RCSB PDB site
Description: structure of the endoglucanase cel6 from mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase, family 6
Deposited on 2003-09-26, released 2004-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.113
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cellulase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UOZ
    • Uniprot O53607 (22-314)
    Domains in SCOPe 2.07: d1uoza1, d1uoza2
  • Heterogens: GLC, SSG, SGC, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uozA (A:)
    mghhhhhhhhhhssghiegrhmanplagkpfyvdpasaamvaarnanppnaeltsvantp
    qsywldqafppatvggtvarytgaaqaagampvltlygiphrdcgsyasggfatgtdyrg
    widavasglgsspatiivepdalamadclspdqrqerfdlvryavdtltrdpaaavyvda
    ghsrwlsaeamaarlndvgvgrargfslnvsnfyttdeeigygeaisgltngshyvidts
    rngagpapdaplnwcnpsgralgappttatagahadaylwikrpgesdgtcgrgepqagr
    fvsqyaidlahnagq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uozA (A:)
    ghiegrhanplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvg
    gtvarytgaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspat
    iivepdalamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarl
    ndvgvgrargfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwc
    npsgralgappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq