PDB entry 1uoy

View 1uoy on RCSB PDB site
Description: the bubble protein from penicillium brevicompactum dierckx exudate.
Deposited on 2003-09-26, released 2003-11-04
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-05, with a file datestamp of 2004-02-05.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.164
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uoya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uoyA (A:)
    dtcgsgynvdqrrtnsgckagngdrhfcgcdrtgvveckggkwtevqdcgsssckgtsng
    gatc