PDB entry 1uow

View 1uow on RCSB PDB site
Description: calcium binding domain c2b
Class: glycoprotein
Keywords: glycoprotein, lipoprotein, transmembrane
Deposited on 2003-09-24, released 2004-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.16658
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin I
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UOW (0-7)
      • conflict (111)
      • conflict (130)
    • Uniprot P21707 (8-End)
    Domains in SCOPe 2.07: d1uowa1, d1uowa2
  • Heterogens: CA, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uowA (A:)
    sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
    lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
    tgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uowA (A:)
    sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
    lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
    tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav