PDB entry 1uov

View 1uov on RCSB PDB site
Description: calcium binding domain c2b
Deposited on 2003-09-24, released 2004-09-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-30, with a file datestamp of 2004-09-30.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.16371
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uova_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uovA (A:)
    sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
    lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
    tgaelrhwsdmlanprrpiaqwhtlqveeevdamlavkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uovA (A:)
    leklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktt
    ikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrh
    wsdmlanprrpiaqwhtlqveeevdamlav